PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA94G00016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 982aa    MW: 108104 Da    PI: 6.3165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA94G00016genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-163177148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       AA94G00016 31 KGQWRPEEDEVLRKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 77
                     799****************************9.************986 PP

2Myb_DNA-binding60.34e-1983129148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd++++d+v +lG+  W+tI+++++ gR +kqc++rw+++l
       AA94G00016  83 KGPWSKEEDKIILDLVDKLGPTKWSTISQHLP-GRIGKQCRERWHNHL 129
                      79******************************.*************97 PP

3Myb_DNA-binding46.21e-14135177145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++ +G++ W+   + ++ gR+++++k++w+
       AA94G00016 135 KEPWTKEEEVTLIHAHRTYGNR-WAELTKFLP-GRSDNSIKNHWN 177
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.522677IPR017930Myb domain
SuperFamilySSF466891.29E-142883IPR009057Homeodomain-like
SMARTSM007171.8E-133079IPR001005SANT/Myb domain
PfamPF002491.2E-133177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-223393IPR009057Homeodomain-like
CDDcd001677.70E-133477No hitNo description
PROSITE profilePS5129431.0478133IPR017930Myb domain
SuperFamilySSF466899.36E-3080176IPR009057Homeodomain-like
SMARTSM007178.3E-1782131IPR001005SANT/Myb domain
PfamPF002491.1E-1783129IPR001005SANT/Myb domain
CDDcd001671.34E-1485129No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2694136IPR009057Homeodomain-like
PROSITE profilePS5129418.95134184IPR017930Myb domain
SMARTSM007175.8E-15134182IPR001005SANT/Myb domain
PfamPF002492.1E-13135178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-21137184IPR009057Homeodomain-like
CDDcd001671.46E-11137177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MTALNHEEES SQGVQKGRHG RTSGPARRST KGQWRPEEDE VLRKAVERFQ GKNWKKIAEC  60
FKDRTDVQCL HRWQKVLNPE LVKGPWSKEE DKIILDLVDK LGPTKWSTIS QHLPGRIGKQ  120
CRERWHNHLN PAINKEPWTK EEEVTLIHAH RTYGNRWAEL TKFLPGRSDN SIKNHWNSSV  180
KKKVESYFQE GLLDEGLSLP LIALKNKSIP SSSSWMQSSG DEGSSRPGAD AEESESSQAS  240
TVFSFSQSTN DLPDEIKSAN EELRGTVSQI SNPATCEEPY YSSCKDVTIA VPELSCKAEC  300
SKRFLNRKIS NEGGITIAKE DQLQDVSNNV KQELDLDGTQ LLTHNMDVDG KNEVLQTFLN  360
PVRLSNPPSM PKSDTGSDPQ AQTLITDEEC CRVLFPDTMK DGQMSSGEQG LNRSDPQKGK  420
CCQSIEAYAH GSGKIPASSC HPSNSDVKEG NNCDHLSKSP VKDSLLYPND SNEPILGCHL  480
IRATATECKT GTKSDFIHSD RPGTSRGNSD CNGISEQQEL SCIPKDSLKL IPLDSFSSPA  540
RVKKIYFPIE EKPADKNNGS LCYEPPRFPS ADIPFFSCDL VSSNSDLRQE YSPFGIRQLM  600
SSSMNYATPL RLWGSPCHDK SPDVMLKDAA KSFTGAPSIL KKRHRDFLSP MLDRRKEKKL  660
KGAVASSLAK DFSRLDVILD EGDDGKSSHS SESSDNKNAS AVPCETKDNK DCASIRSDEE  720
TIPIDEDPKM IHEKACNAAV SSAEKDQEVD HTDVEVRLRS PDQNGSTSND KVNTGGKSPS  780
NQHNISLGTA PTRHNSPEPP CTGESAPLSA IAGNRRNAAE SSANFENFSI FDGTPFKKTL  840
ESPPPWKSPL FFGSFLSSPK LPPEITFEDI GCFMSPGERS YDAIGLLKHL SEHTATAYAD  900
ALEVLGNDTP ESILKKRQLN KSIQGKENQL ENCSNISASA VPVERRTLDF SDCGTPAKAK  960
VSSSSQGSLS SPSSSYLLKS CR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-65311846159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-65311846159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1652659DRRKEKKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974718.10.0myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLF4JV480.0F4JV48_ARATH; Myb-related protein 3R-1
STRINGAT4G32730.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein